PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC27413_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 56aa    MW: 6609.62 Da    PI: 8.0394
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC27413_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.5e-091751337
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl 37
                 k  ++t+eq+e+Le+l++ +++ps  +r++L +++
  RrC27413_p1 17 KYVRYTPEQVEALERLYHDCPKPSSIRRQQLIREC 51
                 5679**************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-81351IPR009057Homeodomain-like
SuperFamilySSF466899.84E-81652IPR009057Homeodomain-like
CDDcd000861.20E-61751No hitNo description
PfamPF000461.6E-61751IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 56 aa     Download sequence    Send to blast
MEMSYKDGKM GCMDNGKYVR YTPEQVEALE RLYHDCPKPS SIRRQQLIRE CPILSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9750429e-64JN975042.1 Brassica napus corona (CNA.2) gene, partial sequence.
GenBankJN9750439e-64JN975043.1 Brassica napus corona (CNA.1) gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009107147.13e-33PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X1
RefseqXP_009107148.13e-33PREDICTED: homeobox-leucine zipper protein ATHB-15-like isoform X2
SwissprotQ9ZU114e-33ATB15_ARATH; Homeobox-leucine zipper protein ATHB-15
TrEMBLM4DCU83e-33M4DCU8_BRARP; Uncharacterized protein
STRINGBra014315.1-P9e-33(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.12e-34HD-ZIP family protein